PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C02280.1.p
Common NameEUGRSUZ_C02280, LOC104437367
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 368aa    MW: 41142.8 Da    PI: 6.2516
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C02280.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.9e-151462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      rg+W++eEd +l+d++++ G+g +W + ++++g++R++k+c++rw++yl
  Eucgr.C02280.1.p 14 RGPWSAEEDAKLKDYIEKDGTGgNWIALPQKIGLNRCGKSCRLRWLNYL 62
                      89*********************************************97 PP

2Myb_DNA-binding37.74.6e-1269111246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g +++eEd l+  +    G++ W+ Ia+ ++ gRt++++k++w++
  Eucgr.C02280.1.p  69 GGFSEEEDNLICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                       569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.871962IPR017930Myb domain
SuperFamilySSF466892.25E-2611109IPR009057Homeodomain-like
SMARTSM007171.2E-101364IPR001005SANT/Myb domain
PfamPF002495.5E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-231569IPR009057Homeodomain-like
CDDcd001672.90E-81662No hitNo description
PROSITE profilePS5129421.29263117IPR017930Myb domain
SMARTSM007177.1E-1167115IPR001005SANT/Myb domain
PfamPF002497.9E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2270117IPR009057Homeodomain-like
CDDcd001672.34E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis